PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09683.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 221aa    MW: 25546.4 Da    PI: 5.7187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09683.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W +eEde+l  +v++ G+++W++ a++ g++R++ +c++rw++yl
  mrna09683.1-v1.0-hybrid 15 KGPWLEEEDERLTMYVRLKGNRRWDALAKESGLRRSGRSCRLRWLNYL 62
                             79********************************************97 PP

2Myb_DNA-binding537.7e-1771113448
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               T eE+++++++++++G++ W++Iar+++ gRt++++k++w+++l
  mrna09683.1-v1.0-hybrid  71 ITVEEEKIILQLHELWGNK-WSKIARMLP-GRTDNEIKNYWRTHL 113
                              599****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.661062IPR017930Myb domain
SuperFamilySSF466891.12E-2612109IPR009057Homeodomain-like
SMARTSM007172.7E-121464IPR001005SANT/Myb domain
PfamPF002496.0E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-201669IPR009057Homeodomain-like
CDDcd001671.73E-81762No hitNo description
PROSITE profilePS5129425.41263117IPR017930Myb domain
SMARTSM007171.4E-1567115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370116IPR009057Homeodomain-like
PfamPF002492.0E-1571113IPR001005SANT/Myb domain
CDDcd001675.36E-1272113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAYEAAAVEG ENLRKGPWLE EEDERLTMYV RLKGNRRWDA LAKESGLRRS GRSCRLRWLN  60
YLRPNLKHGH ITVEEEKIIL QLHELWGNKW SKIARMLPGR TDNEIKNYWR THLVKKAQIQ  120
DGDAASAGNL QCTSNKAQQG YFFQEGGDMS ADKKYEFDQY QDSVEDIWGA RETYSDDLCL  180
SDFALPSSPY ETRLSDWIFE LSSEQSGITW TSDHDTNAKK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25131172105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306261.11e-163PREDICTED: transcription factor MYB59
SwissprotQ53NK63e-50MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLM5VUK71e-106M5VUK7_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s12400.18e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.13e-51myb domain protein 27